PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB05G11880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 1654aa    MW: 180052 Da    PI: 6.6224
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB05G11880.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.39.8e-10793835347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE e++ +  + +G++ +++I++ ++ ++t  +c+++++k+
     OB05G11880.1 793 PWTQEEKEIFMEKLATFGKD-FSKISSFLQ-HKTTADCVEFYYKH 835
                      8*****************99.*********.************97 PP

2Myb_DNA-binding22.23.3e-0710011040445
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding    4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45  
                       W  +E  +++da + +G++ +++I++++   ++ +qck ++ 
     OB05G11880.1 1001 WNDDEKSRFIDAMNSYGKD-FARISSCVK-SKSSEQCKVFFS 1040
                       *****************99.********9.********8776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.64E-15776838IPR009057Homeodomain-like
PROSITE profilePS5129317.543789840IPR017884SANT domain
SMARTSM007173.6E-10790838IPR001005SANT/Myb domain
PfamPF002491.2E-7792835IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-7793837IPR009057Homeodomain-like
PROSITE profilePS5129312.6949961047IPR017884SANT domain
SMARTSM007177.4E-69971045IPR001005SANT/Myb domain
SuperFamilySSF466895.69E-810001048IPR009057Homeodomain-like
CDDcd001675.97E-510011039No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1654 aa     Download sequence    Send to blast
MLPMPPPPPR TSLSSLIRQN RSAISEGYYR QGGASYDRSY PDESLGYTPS RSDRYWVEDE  60
DGGYKGFGRY GGGGGGSRRD GRDIRGSYRR SPFRGYGSDF SRNHQEHPPP PLRRSPLRSV  120
AVPMCYDPPG DKAERGDRDH HHRVTPWRPL RRRESRSDAG DTSGAEPVPA GQATTAAASE  180
KDACPDFSAN HQEHPSPPPR RSPLRSVAVP MCYDPPGDRA ERGDKDHHHR VTPWRPLRRR  240
ENRSDAADAS GAGPVPAGQA TAAVSSEKDS SAQSLAVAAP QASEEEAPRK KPRLGWGQGL  300
AKYEKQKVHG PADSAEAVAE GSPTSTDQKA VTNTPAFAPC VSPVATPSPA PLCKSPVPED  360
KSCEMTANTV TESNKNIPVA DVQACNNEVP TTLDQLEGDP IDSLAKVLSV LVQHEDSCSG  420
DSKGLTNGSK LLLLKESISK ELEKTELEID SLEGELKSVT TKARNRALKD PPKALTYAQN  480
PLPSPVKEQG ELTPSPKISM EQDADVKGSE LMEVETAQAH NAKAVSSEES VACPGVAQGQ  540
VPAAADVIPS DPSGKIGSGI DVDNGQHEEN PCHDNFNAMK ADDNSDLTRP CSYHGVKYNL  600
VDTVLSMNRS LAKNTSELLF KPVLADRSHL DLLESSHLSS QMKNGLIIKK KYAILKNQQR  660
FKEQILTFKF RVLRHLWKED VRLLSVRKQR SKSHKRTEQN NRAPQSGSQR QRSSNRSRFA  720
VPAGNLSTFP ITEMSDIANK MFSEFQLKRC RNYLKMPSMI VDEKEKAVAM FVNKNGLVED  780
PISVEKERSL FNPWTQEEKE IFMEKLATFG KDFSKISSFL QHKTTADCVE FYYKHHKSDS  840
FREVKKLLDL RQQQQPASNY LAAVSGKKWN PEANAALLDM LGVATEVAAQ GLEYANEVKK  900
NSVKSIMQIA CGAANSTKGS EDCVGDVSLH ERESVAADVL AGICGTLSPE GMGSCITSSA  960
DHGQKIGISR MEHLLTPEAD KNFDDDGTLS DQECEVDIVD WNDDEKSRFI DAMNSYGKDF  1020
ARISSCVKSK SSEQCKVFFS KARKSLGLDL IHQGGADAGF PTGDANGGRS GTDGACIAEM  1080
DSAICSAQSC PEMEVDACPI SDGDIQGHDP LSGVASKQPE ADKSNVPDED INAKEGGRKA  1140
EKDCSIIDHK QLCEDARETS YPRIDINCPD STDKLQDTED VKPVNMHAND AMVSSVEQAV  1200
AAHVETRTSS HSVEVIESSR ASKEIVMDVS RMEGRSHETA ICKGGKSTPP VCLPALGVSK  1260
ENIIHFSNMD EATPIRPAFT SNYQQTKLAD PMQSKPKPLT PKDLMPVQFT TSLPDPTSIC  1320
FEGIAAITTP NFEDDGNKTS IASGAKDVSM FPAYKDQSGN HHDPLFHNVE GYMQQRRNNH  1380
FRTEVPVLSE STIGGNAGVS QLDHFMVSKF QNGRSSSLGL SNGNLGVLST GRREEVREGL  1440
FTPCSVKASS GNEQQQKRPG DVKLFGQILS HQSSLQSSGS STHGSKSKPL SPKVDKSASR  1500
LLSNSRECLV YSSRPPNIAN LGLEERTMRS YDHFDTVQTI QPEPMVMVAK CQRSSAGVPV  1560
YSTKNGALSV FRELQPPSVQ PLSSDHKLLE NFGDIHKRNG IELISGFQQP GRLGSAGVLV  1620
SSVSDPVAAL KAQYGPGSKM LSNDVDTWKD IGSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_D1e-17751842494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_C1e-17751842494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0706530.0AK070653.1 Oryza sativa Japonica Group cDNA clone:J023055D14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006654948.20.0PREDICTED: uncharacterized protein LOC102700148, partial
TrEMBLJ3M3L40.0J3M3L4_ORYBR; Uncharacterized protein
STRINGOB05G11880.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-83MYB family protein